Mouse Anti-Cattle NUDT21 Antibody (MO-AB-17030R)


Cat: MO-AB-17030R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17030R
SpecificityThis antibody binds to Cattle NUDT21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3''-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3''-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3''-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5''-UGUA-3'' elements localized in the 3''-untranslated region (UTR) for a huge number of pre-mRNAs.
Product OverviewThis product is a mouse antibody against NUDT21. It can be used for NUDT21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCleavage and polyadenylation specificity factor subunit 5; Nucleoside diphosphate-linked moiety X motif 21; Nudix motif 21; NUDT21; CPSF5
UniProt IDQ3ZCA2
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry