Mouse Anti-Zebrafish nudt21 Antibody (CBMOAB-63913FYA)


Cat: CBMOAB-63913FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63913FYA
SpecificityThis antibody binds to Zebrafish nudt21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs.
Product OverviewMouse Anti-Zebrafish nudt21 Antibody is a mouse antibody against nudt21. It can be used for nudt21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNudix Hydrolase 21; Cleavage And Polyadenylation Specificity Factor 25 KDa Subunit; Cleavage And Polyadenylation Specific Factor 5, 25 KD Subunit; Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21; Cleavage And Polyadenylation Specific Factor 5, 25 KDa; Nucleoside Diphosphate-Linked Moiety X Motif 21; Pre-MRNA Cleavage Factor Im 25 KDa Subunit; Cleavage Factor Im Complex 25 KDa Subunit; CPSF 25 KDa Subunit
UniProt IDB2GS95
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MSVVPPNRSSTGWPRGVNQFGNKYITQATKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFEKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVKQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN.
See other products for " NUDT21 "
MO-AB-60460WMouse Anti-Marmoset NUDT21 Antibody (MO-AB-60460W)
MO-AB-25028WMouse Anti-Chimpanzee NUDT21 Antibody (MO-AB-25028W)
CBMOAB-37706FYCMouse Anti-Arabidopsis NUDT21 Antibody (CBMOAB-37706FYC)
MO-AB-17030RMouse Anti-Cattle NUDT21 Antibody (MO-AB-17030R)
MO-AB-27609HMouse Anti-Rat Nudt21 Antibody (MO-AB-27609H)
CBMOAB-53143FYAMouse Anti-Rhesus NUDT21 Antibody (CBMOAB-53143FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry