Mouse Anti-Cattle PGM1 Antibody (MO-AB-17836R)


Cat: MO-AB-17836R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17836R
SpecificityThis antibody binds to Cattle PGM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMinor phosphoglucomutase isozyme that catalyzes the interconversion of glucose 1-phosphate and glucose 6-phosphate (PubMed:5784209). Constitutes about 10-20% of the phosphoglucomutase activity in the cell (PubMed:14264884, PubMed:5231755). Key enzyme in hexose metabolism. The forward reaction is an essential step in the energy metabolism of galactose since the product of the galactose pathway enzymes in yeast is glucose 1-phosphate. The reverse reaction is an essential step for biosynthesis when carbon sources other than galactose are the energy source because glucose 1-phosphate is the starting point for the synthesis of UDP-glucose, which acts as a precursor for the synthesis of oligosaccharides and trehalose (PubMed:14264884).
Product OverviewThis product is a mouse antibody against PGM1. It can be used for PGM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphoglucomutase-1; PGM1
UniProt IDF1MJS4
Protein RefseqThe length of the protein is 566 amino acids long.
The sequence is show below: MEEGPLPLLTFTTAPYYDQKPGTSGLRKKTYYFEEKPCYLENFIQSIFFSIDLKDRQGASLVVGGDGRYFNKSAIETIVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLHVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNC.
For Research Use Only | Not For Clinical Use.
Online Inquiry