Mouse Anti-Frog pgm1 Antibody (MO-AB-06208H)


Cat: MO-AB-06208H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO06208C
SpecificityThis antibody binds to Frog pgm1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. In most cell types, this PGM isozyme is predominant, representing about 90% of total PGM activity. In red cells, PGM2 is a major isozyme. This gene is highly polymorphic. Mutations in this gene cause glycogen storage disease type 14. Alternativley spliced transcript variants encoding different isoforms have been identified in this gene.
Product OverviewThis product is a mouse antibody against pgm1. It can be used for pgm1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPgm2-prov protein; pgm1
UniProt IDQ7ZYA3
Protein RefseqThe length of the protein is 562 amino acids long.
The sequence is show below: MVKIQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTEPAERQDGVLVVGGDGRFYMKEAIQLIIQIAAANGIGRLVIGQNGILSTPAVSCIIRKVKANGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLATIGKQQFDLENKFKPFTVEIVDSVEAYGNMLRNIFDFSALKELLSGQNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAGIAANIFSIPYFQQTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIATRKQSVEEILKDHWQKYGRNFFTRYDYEEVDAEGANTMMKDLEALMFDRSFIGQQLSAGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVILAPLITIALKISKLQERTGRTAPTVIT.
For Research Use Only | Not For Clinical Use.
Online Inquiry