Mouse Anti-Cattle PTPRC Antibody (MO-AB-18836R)
Cat: MO-AB-18836R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO18836R |
Specificity | This antibody binds to Cattle PTPRC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Protein tyrosine phosphatase, receptor type, C, also known as PTPRC, is an enzyme encoded by the PTPRC gene in humans. PTPRC is also called CD45 antigen (CD stands for differentiation cluster) and was originally called Leukocyte Common Antigen (LCA). The protein product of this gene, most famously CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTP is a signaling molecule that regulates various cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 is a type I transmembrane protein and exists in various isoforms in all differentiated hematopoietic cells (except red blood cells and plasma cells). CD45 has been shown to be an important regulator of T cell and B cell antigen receptor signal transduction. It plays a role by directly interacting with the components of the antigen receptor complex through its extracellular domain (a form of co-stimulation), or through its cytoplasmic domain to activate various Src family kinases required for antigen receptor signal transduction. CD45 can also inhibit JAK kinase, so it can be used as a negative regulator of cytokine receptor signal transduction. |
Product Overview | This product is a mouse antibody against PTPRC. It can be used for PTPRC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | PTPRC protein, Fragment; PTPRC |
UniProt ID | A6QNL1 |
Protein Refseq | The length of the protein is 806 amino acids long. The sequence is show below: MYLWLKLLAFGFAFLDIAVFVAGNSTQPSTQDEQTTTPALTTASSVSPATALSTIAPTKPPCENKYGGVSVKYSFNDNKTFTATLDVKREECEPPGCEKEHRGLSACQTKNISMSHPSCEPPFEYVLEVPPDPNQFQLVDCVEDEEANTSLCLHWQNKDFPDNGQFKCNENKIEYKFKCDGGSPSYNKDTFKVRNLKPRTNYTCSSQVLYDQQLLISQNKTIETDFGEPEAPQNFTCSAKNATEGKCTWTPPQSY. |
See other products for " PTPRC "
CBMOAB-00051FYA | Mouse Anti-Cattle PTPRC Antibody (CBMOAB-00051FYA) |
MO-AB-03644Y | Mouse Anti-Chicken Ptprc Antibody (MO-AB-03644Y) |
MO-AB-46261W | Mouse Anti-Horse PTPRC Antibody (MO-AB-46261W) |
CBMOAB-00050FYA | Mouse Anti-Cattle PTPRC Antibody (CBMOAB-00050FYA) |
MO-AB-25498W | Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-25498W) |
CBMOAB-00136FYA | Mouse Anti-Dog PTPRC Antibody (CBMOAB-00136FYA) |
MO-AB-26853W | Mouse Anti-Chimpanzee PTPRC Antibody (MO-AB-26853W) |
MO-AB-05415W | Mouse Anti-Rhesus PTPRC Antibody (MO-AB-05415W) |
MOFY-0522-FY68 | Rat Anti-PTPRC Antibody (MOFY-0522-FY68) |
CBMOAB-00049FYA | Mouse Anti-Cattle PTPRC Antibody (CBMOAB-00049FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry