Mouse Anti-Cattle RSPO2 Antibody (MO-AB-19632R)


Cat: MO-AB-19632R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19632R
SpecificityThis antibody binds to Cattle RSPO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against RSPO2. It can be used for RSPO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRSPO2 protein, Fragment; RSPO2
UniProt IDA5PKH7
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: LFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFEECPDGFAALDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKKNKKKKRKLIERAQEQHSVFLATDRANQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry