Mouse Anti-Cattle SPAG6 Antibody (MO-AB-20767R)


Cat: MO-AB-20767R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO20767R
SpecificityThis antibody binds to Cattle SPAG6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against SPAG6. It can be used for SPAG6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm associated antigen 6; SPAG6
UniProt IDQ32L54
Protein RefseqThe length of the protein is 509 amino acids long.
The sequence is show below: MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMALLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAVSALSDIAKHSPELAQTVVDAGVIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry