Mouse Anti-Cattle SPN Antibody (MO-AB-20832R)


Cat: MO-AB-20832R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO20832R
SpecificityThis antibody binds to Cattle SPN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular domain, a transmembrane region and a carboxy-terminal intracellular region. The extracellular domain has a high proportion of serine and threonine residues, allowing extensive O-glycosylation, and has one potential N-glycosylation site, while the carboxy-terminal region has potential phosphorylation sites that may mediate transduction of activation signals. Different glycoforms of this protein have been described. In stimulated immune cells, proteolytic cleavage of the extracellular domain occurs in some cell types, releasing a soluble extracellular fragment. Defects in expression of this gene are associated with Wiskott-Aldrich syndrome.
Product OverviewThis product is a mouse antibody against SPN. It can be used for SPN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPN protein; SPN
UniProt IDA6QQP5
Protein RefseqThe length of the protein is 482 amino acids long.
The sequence is show below: MGAENVTEVSSRSSPLWTSKTTIASLSSVSETLTFNSVTTSLTTNEVSKMSDNPEHQTLPPSSIPYIADVVSSPETSPTASRGSPVSESTISKEDSSKKSIKLMKTPDATSTPGVSVMKPTGFPTMTSKTMATSPLETSSATSKVLLTMATSSLEISGGTSRPPVSMAMSSLDTSSGTSEVLLTMATSSLDISGGTSRPPVSMATSSLDTSSGTSEVLLTMATSSLDISGGTSRPPVTMATSSLETSSGTREPLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry