Mouse Anti-Cattle SRP9 Antibody (MO-AB-20898R)
Cat: MO-AB-20898R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO20898R |
| Specificity | This antibody binds to Cattle SRP9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding. |
| Product Overview | This product is a mouse antibody against SRP9. It can be used for SRP9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Signal recognition particle 9kDa; SRP9 |
| UniProt ID | Q2NKU2 |
| Protein Refseq | The length of the protein is 63 amino acids long. The sequence is show below: MPQYQTWEEFSRAAEKLYLADPMKCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRSVAMETD. |
See other products for " SRP9 "
| MO-AB-01447L | Mouse Anti-Elephant SRP9 Antibody (MO-AB-01447L) |
| MO-AB-10091Y | Mouse Anti-Rabbit SRP9 Antibody (MO-AB-10091Y) |
| MO-AB-21767W | Mouse Anti-Chimpanzee SRP9 Antibody (MO-AB-21767W) |
| CBMOAB-07347FYB | Mouse Anti-Zebrafish srp9 Antibody (CBMOAB-07347FYB) |
| MO-AB-33524W | Mouse Anti-Dog SRP9 Antibody (MO-AB-33524W) |
| MO-AB-08880W | Mouse Anti-Cat SRP9 Antibody (MO-AB-08880W) |
| CBMOAB-31986FYA | Mouse Anti-D. melanogaster Srp9 Antibody (CBMOAB-31986FYA) |
| MO-AB-29200H | Mouse Anti-Rat Srp9 Antibody (MO-AB-29200H) |
| MO-AB-06258W | Mouse Anti-Rhesus SRP9 Antibody (MO-AB-06258W) |
| CBMOAB-41784FYC | Mouse Anti-Arabidopsis SRP9 Antibody (CBMOAB-41784FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry