Mouse Anti-D. melanogaster Srp9 Antibody (CBMOAB-31986FYA)
Cat: CBMOAB-31986FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO31986FYA |
Specificity | This antibody binds to fruit fly Srp9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | SRP9 (Signal Recognition Particle 9) is a Protein Coding gene. Among its related pathways are Gene Expression and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include RNA binding and signal recognition particle binding. |
Product Overview | Mouse Anti-D. melanogaster Srp9 Antibody is a mouse antibody against Srp9. It can be used for Srp9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Signal recognition particle 9 kDa protein; SRP9; Srp9 |
UniProt ID | Q9VSC1 |
Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKITSNLVGHMASKE. |
See other products for " SRP9 "
MO-AB-01447L | Mouse Anti-Elephant SRP9 Antibody (MO-AB-01447L) |
MO-AB-06915Y | Mouse Anti-O. anatinus SRP9 Antibody (MO-AB-06915Y) |
MO-AB-70445W | Mouse Anti-Silkworm SRP9 Antibody (MO-AB-70445W) |
MO-AB-20898R | Mouse Anti-Cattle SRP9 Antibody (MO-AB-20898R) |
MO-AB-46691W | Mouse Anti-Horse SRP9 Antibody (MO-AB-46691W) |
MO-AB-04141Y | Mouse Anti-Chicken SRP9 Antibody (MO-AB-04141Y) |
MO-AB-65334W | Mouse Anti-Marmoset SRP9 Antibody (MO-AB-65334W) |
MO-AB-33853H | Mouse Anti-Nile tilapia srp9 Antibody (MO-AB-33853H) |
MO-AB-33524W | Mouse Anti-Dog SRP9 Antibody (MO-AB-33524W) |
MO-AB-29200H | Mouse Anti-Rat Srp9 Antibody (MO-AB-29200H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry