Mouse Anti-Nile tilapia srp9 Antibody (MO-AB-33853H)
Cat: MO-AB-33853H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Nile tilapia (Oreochromis niloticus) |
| Clone | MO33853C |
| Specificity | This antibody binds to Nile tilapia srp9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | SRP9 (Signal Recognition Particle 9) is a protein coding gene. Among its related pathways are Gene Expression and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include RNA binding and signal recognition particle binding. |
| Product Overview | This product is a mouse antibody against srp9. It can be used for srp9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Signal recognition particle 9 kDa protein; SRP9; LOC100692742 |
| UniProt ID | I3JZR3 |
| Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MPYYQTWEEFARAAEKLYLTDPMKVRVVLKYRHCDGNLSIKVTDNAVCLQYKTDQAQDVKKIEKLHGKLMRLMVSKETHSGAMETD. |
See other products for " SRP9 "
| MO-AB-46691W | Mouse Anti-Horse SRP9 Antibody (MO-AB-46691W) |
| MO-AB-29200H | Mouse Anti-Rat Srp9 Antibody (MO-AB-29200H) |
| MO-AB-33524W | Mouse Anti-Dog SRP9 Antibody (MO-AB-33524W) |
| MO-AB-08880W | Mouse Anti-Cat SRP9 Antibody (MO-AB-08880W) |
| MO-AB-06915Y | Mouse Anti-O. anatinus SRP9 Antibody (MO-AB-06915Y) |
| MO-AB-17106H | Mouse Anti-Malaria parasite SRP9 Antibody (MO-AB-17106H) |
| MO-AB-65334W | Mouse Anti-Marmoset SRP9 Antibody (MO-AB-65334W) |
| CBMOAB-41784FYC | Mouse Anti-Arabidopsis SRP9 Antibody (CBMOAB-41784FYC) |
| CBMOAB-07347FYB | Mouse Anti-Zebrafish srp9 Antibody (CBMOAB-07347FYB) |
| MO-AB-20898R | Mouse Anti-Cattle SRP9 Antibody (MO-AB-20898R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry