Mouse Anti-Chicken SRP9 Antibody (MO-AB-04141Y)
Cat: MO-AB-04141Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO04141Y |
Specificity | This antibody binds to Chicken SRP9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding. |
Product Overview | This product is a mouse antibody against SRP9. It can be used for SRP9 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Signal recognition particle 9 kDa protein; SRP9; SRP9 |
UniProt ID | Q5ZHT7 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MPHYQAWEEFTRAAEKLYLADPMKVRVVLKYRHCDGNLCIKVTDDVACLLYRTDQAQDVKKIEKFHSQLMRLMVAKESRSAAMETD. |
See other products for " SRP9 "
MO-AB-33524W | Mouse Anti-Dog SRP9 Antibody (MO-AB-33524W) |
MO-AB-46691W | Mouse Anti-Horse SRP9 Antibody (MO-AB-46691W) |
MO-AB-01447L | Mouse Anti-Elephant SRP9 Antibody (MO-AB-01447L) |
CBMOAB-31986FYA | Mouse Anti-D. melanogaster Srp9 Antibody (CBMOAB-31986FYA) |
MO-AB-20898R | Mouse Anti-Cattle SRP9 Antibody (MO-AB-20898R) |
MO-AB-08880W | Mouse Anti-Cat SRP9 Antibody (MO-AB-08880W) |
MO-AB-08014H | Mouse Anti-Frog srp9 Antibody (MO-AB-08014H) |
CBMOAB-41784FYC | Mouse Anti-Arabidopsis SRP9 Antibody (CBMOAB-41784FYC) |
MO-AB-29200H | Mouse Anti-Rat Srp9 Antibody (MO-AB-29200H) |
MO-AB-70445W | Mouse Anti-Silkworm SRP9 Antibody (MO-AB-70445W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry