Mouse Anti-Cattle TPP1 Antibody (MO-AB-22079R)


Cat: MO-AB-22079R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22079R
SpecificityThis antibody binds to Cattle TPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
Product OverviewThis product is a mouse antibody against TPP1. It can be used for TPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTripeptidyl-peptidase 1; TPP1
UniProt IDF1MK08
Protein RefseqThe length of the protein is 563 amino acids long.
The sequence is show below: MGPRSGLLGLFALFVAGKCSYSPEPDQQRRLPPGWVSLGRADPEEELSLTFALRQQNVKRLSELVQAVSDPGSPRYGKYLTLEDVAELVRPSPLTLHTVQKWLLAAGARNCHSVTTQDFLTCWLSVRQAELLLSGAEFHHYVGGPAETHAVRSLHPYRLPKALAPHVDFVGGLHRFPPTSTLRQHPEPQVPGTVGLHLGVTPSVIRKRYNLTAQDVGSGTTNNSQACAQFLEQYFHDSDLAEFMRLFGGDFAHQA.
See other products for " TPP1 "
CBMOAB-04574CRMouse Anti-Yeast TPP1 Antibody (CBMOAB-04574CR)
MO-AB-33819WMouse Anti-Dog TPP1 Antibody (MO-AB-33819W)
MO-DKB-03828WRabbit Anti-TPP1 Antibody (Cat MO-DKB-03828W)
CBMOAB-89698FYBMouse Anti-Rice TPP1 Antibody (CBMOAB-89698FYB)
MO-AB-25126WMouse Anti-Chimpanzee TPP1 Antibody (MO-AB-25126W)
MO-AB-08663HMouse Anti-Frog tpp1 Antibody (MO-AB-08663H)
MO-AB-66771WMouse Anti-Marmoset TPP1 Antibody (MO-AB-66771W)
CBMOAB-10520FYBMouse Anti-Zebrafish tpp1 Antibody (CBMOAB-10520FYB)
CBMOAB-45224FYCMouse Anti-Arabidopsis TPP1 Antibody (CBMOAB-45224FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry