Mouse Anti-Cattle TPP2 Antibody (MO-AB-22081R)


Cat: MO-AB-22081R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22081R
SpecificityThis antibody binds to Cattle TPP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mammalian peptidase that, at neutral pH, removes tripeptides from the N terminus of longer peptides. The protein has a specialized function that is essential for some MHC class I antigen presentation. The protein is a high molecular mass serine exopeptidase; the amino acid sequence surrounding the serine residue at the active site is similar to the peptidases of the subtilisin class rather than the trypsin class.
Product OverviewThis product is a mouse antibody against TPP2. It can be used for TPP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II; TPP2
UniProt IDA5PK39
Protein RefseqThe length of the protein is 1249 amino acids long.
The sequence is show below: MATAATEEPFPFHGLLPKKETGAAAFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATVVEPKDGEIVGLSGRVLKIPVTWTNPSGRYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRAALAEACRKQEEFDVANNCPSQANKLIKEELHSQVELLNSFEKKYSDPGPVYDCLVWFDGETWRACIDSSEDGDLSKSTVLRNYKEAQEYGSFGAAEMLNYSVNIYDDGNLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry