Mouse Anti-Cattle WNT2 Antibody (MO-AB-22982R)


Cat: MO-AB-22982R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22982R
SpecificityThis antibody binds to Cattle WNT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene.
Product OverviewThis product is a mouse antibody against WNT2. It can be used for WNT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt-2; WNT2
UniProt IDA4D7S0
Protein RefseqThe length of the protein is 360 amino acids long.
The sequence is show below: MNACLVGIWLWLPLLFTWLSPEVSSSWWYMRATSGSSRVMCDNVPGLVSHQRQLCHRHPDVMRAIGLGVTEWTMECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGTAKDNKGTFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGNYLWRKYNGAIQVVMNQDGTGFTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry