AibGenesis™ Mouse Anti-CAVIN3 Antibody (MO-AB-09568R)


Cat: MO-AB-09568R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09568R Monoclonal Cattle (Bos taurus), Ferret (Mustela Putorius Furo) WB, ELISA MO09568R 100 µg
Inquiry
MO-AB-34490W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34490W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Ferret (Mustela Putorius Furo)
CloneMO09568R
SpecificityThis antibody binds to Cattle CAVIN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein. (From NCBI)
Product OverviewMouse Anti-Cattle CAVIN3 Antibody is a mouse antibody against CAVIN3. It can be used for CAVIN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein kinase C delta-binding protein; Cavin-3; PRKCDBP
UniProt IDA4FV37
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MGESALESGPVPGAPAGGPVHAVTVVTLLEKLATMLETLRERQGGLAQRQGGLAGSVRRIQSNLGALSRSHDTTSNTLAQLLAKAERVGSHADAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEAEIPAKAFQKAPEPLGPVELGPQLPEAEAEESSDEEEPVESRARRLRRTGLEKVQSLRRALSGRKGHAAPTPTPVKPPRLGPGRSAEGQWEAQPALESKLEPEPPQDTEEDPGRPGAAEAAAVLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry