AibGenesis™ Mouse Anti-Cbp20 Antibody (CBMOAB-03161FYA)


Cat: CBMOAB-03161FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03161FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Rice (Oryza) WB, ELISA MO03161FYA 100 µg
CBMOAB-22061FYB Monoclonal Rice (Oryza) WB, ELISA MO22061FYB 100 µg
CBMOAB-25792FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO25792FC 100 µg
MO-AB-00334H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00334C 100 µg
MO-DKB-0097RA Polyclonal A. thaliana (Arabidopsis thaliana) IP, WB 200 µg
MO-DKB-01701W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Rice (Oryza)
CloneMO03161FYA
SpecificityThis antibody binds to fruit fly Cbp20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Cbp20 Antibody is a mouse antibody against Cbp20. It can be used for Cbp20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear cap-binding protein subunit 2; 20 kDa nuclear cap-binding protein; NCBP 20 kDa subunit; CBP20; Cbp20
UniProt IDQ9V3L6
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MFASVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKIAPNTDNR.
For Research Use Only | Not For Clinical Use.
Online Inquiry