AibGenesis™ Mouse Anti-CCDC12 Antibody (CBMOAB-38299FYA)


Cat: CBMOAB-38299FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38299FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38299FYA 100 µg
CBMOAB-69296FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69296FYA 100 µg
MO-AB-02132H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02132C 100 µg
MO-AB-09604R Monoclonal Cattle (Bos taurus) WB, ELISA MO09604R 100 µg
MO-AB-24544H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24544C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38299FYA
SpecificityThis antibody binds to Rhesus CCDC12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC12 Antibody is a mouse antibody against CCDC12. It can be used for CCDC12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 12; CCDC12
UniProt IDH9F7U4
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: AGVGRLEEEALRRKERLKALREKTGRKDKEDGEPRTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQDDSLASAVDAATEQKACDSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry