AibGenesis™ Mouse Anti-CCDC132 Antibody (CBMOAB-38320FYA)


Cat: CBMOAB-38320FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38320FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO38320FYA 100 µg
MO-AB-01533W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01533W 100 µg
MO-AB-09611R Monoclonal Cattle (Bos taurus) WB, ELISA MO09611R 100 µg
MO-AB-52379W Monoclonal Marmoset WB, ELISA MO52379W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO38320FYA
SpecificityThis antibody binds to Rhesus CCDC132.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC132 Antibody is a mouse antibody against CCDC132. It can be used for CCDC132 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC132
UniProt IDF7HQA8
Protein RefseqThe length of the protein is 458 amino acids long.
The sequence is show below: MLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTHVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHDNEDTASASEGNNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDVPVKSVSRETLKSRKKSDYSLNKVNAPILTNTTLNVIRLVGYVYMKSKNVHNSYPRHSLPGIRIPRKVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry