AibGenesis™ Mouse Anti-CCDC184 Antibody (MO-AB-09629R)


Cat: MO-AB-09629R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09629R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO09629R 100 µg
MO-AB-24555H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24555C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO09629R
SpecificityThis antibody binds to Cattle CCDC184.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CCDC184 Antibody is a mouse antibody against CCDC184. It can be used for CCDC184 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 184; CCDC184
UniProt IDQ0VC19
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MEEGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGNKGNFPGARRDPETPSPGIGDSGLLGRDPEDEEDDDEEEKEMPSSATPTSHCELPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEASL.
For Research Use Only | Not For Clinical Use.
Online Inquiry