AibGenesis™ Mouse Anti-CCDC42 Antibody (CBMOAB-38425FYA)


Cat: CBMOAB-38425FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38425FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38425FYA 100 µg
MO-AB-09640R Monoclonal Cattle (Bos taurus) WB, ELISA MO09640R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38425FYA
SpecificityThis antibody binds to Rhesus CCDC42.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC42 Antibody is a mouse antibody against CCDC42. It can be used for CCDC42 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC42
UniProt IDF6UAJ1
Protein RefseqThe length of the protein is 242 amino acids long.
The sequence is show below: MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVQGQSESPSIRLLEKKKETKIMHHNMLQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKFEQFIQENDQKRIRAMKKANKERELKRQHMQELSKGKQEMVALRLEHQRLSAKLQDYSIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKQLKEVTEVALEDTHKQLDMIQQFIQDLSDIWAEVKKKEQQQVRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry