AibGenesis™ Mouse Anti-ccdc53 Antibody (CBMOAB-69403FYA)


Cat: CBMOAB-69403FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69403FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster) WB, ELISA MO69403FYA 100 µg
MO-AB-02335W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02335W 100 µg
MO-AB-14748W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14748W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster)
CloneMO69403FYA
SpecificityThis antibody binds to Zebrafish ccdc53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs at least in part as component of the WASH complex which may regulate wash nucleation-promoting factor (NPF) activity and is required for its membrane targeting during endosomal sorting. During embryogenesis, not involved in the wash-dependent developmental migration of hemocytes anteriorly from the tail (PubMed:25739458). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ccdc53 Antibody is a mouse antibody against ccdc53. It can be used for ccdc53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWASH complex subunit CCDC53; Coiled-coil domain-containing protein 53; ccdc5
UniProt IDQ5RGJ6
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MDADGLPIVGSGVDLTKVPAIQQRRIVAFLNQFIVHTVRFLNRFSTVCEEKLSTVSLRIQQIETTLSILEAKLASIPGLEEVTVDGVRAPAETNGPAADTSRATAPPAEASQQTQAAPQEPKTEAPAENIMTVAKDPRYARYLKMVQVGVPVMAIKNKMMMEGLDPNLLDTPDAAVPDASKKRLEEQDDDSSGSESSFSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry