AibGenesis™ Mouse Anti-CCDC68 Antibody (CBMOAB-38462FYA)


Cat: CBMOAB-38462FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38462FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO38462FYA 100 µg
MO-AB-25815W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25815W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO38462FYA
SpecificityThis antibody binds to Rhesus CCDC68.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC68 Antibody is a mouse antibody against CCDC68. It can be used for CCDC68 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC68
UniProt IDF7E4J3
Protein RefseqThe length of the protein is 335 amino acids long.
The sequence is show below: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLEKIRTQMFKDEIRHDSTNNKLDTKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMHKENEVLKIKLEASREAGAAALRNVARRLFENYQTQSEEVRKKHEDSKHLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATCGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSIIQKMEGLKNNLKEQDKRIENLKEKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry