AibGenesis™ Mouse Anti-CCNK Antibody (CBMOAB-38575FYA)


Cat: CBMOAB-38575FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38575FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO38575FYA 100 µg
CBMOAB-69589FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69589FYA 100 µg
MO-AB-02179H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02179C 100 µg
MO-AB-07478Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07478Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO38575FYA
SpecificityThis antibody binds to Rhesus CCNK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCNK Antibody is a mouse antibody against CCNK. It can be used for CCNK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-K; CCNK
UniProt IDH9FCG3
Protein RefseqThe length of the protein is 59 amino acids long.
The sequence is show below: PRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR.
For Research Use Only | Not For Clinical Use.
Online Inquiry