Mouse Anti-ccr7 Antibody (MO-AB-02186H)


Cat: MO-AB-02186H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02186H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO02186C 100 µg
CBMOAB-69622FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69622FYA 100 µg
MO-AB-09740R Monoclonal Cattle (Bos taurus) WB, ELISA MO09740R 100 µg
MO-AB-01031Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01031Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO02186C
SpecificityThis antibody binds to Frog ccr7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR7 (C-C Motif Chemokine Receptor 7) is a Protein Coding gene. Diseases associated with CCR7 include Chronic Actinic Dermatitis and Pars Planitis. Among its related pathways are Akt Signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine (C-C motif) ligand 19 binding. An important paralog of this gene is CCR9.
Product OverviewThis product is a mouse antibody against ccr7. It can be used for ccr7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80638 protein; MGC80638
UniProt IDQ6GP68
Protein RefseqThe length of the protein is 358 amino acids long.
The sequence is show below: MATFQLAVGEDNVSTDENVPYSTMDYSDLQTVCQKGDVRTFRSSFLPAMYTIICLVGLAGNGLVMIRYLYFNRLKNGTDYYMLNLAIADIVFLLTLPFWAVSVAKNWVFGSEMCKIIYCLYKMSFFSGMFLLMCVSMERYFAIVQAPSAHRHRSKTVLISKLSSLGIWVFAFLLSIPELLYSGVNNNGGVNMCIIFSNSIQSLSAKLKISQMFFGFFLPLIIMALCYCMIIRKLLQARNFEKYKAIKVIIAIVIVFVAFQLPYNSVMLIKTFDNGTDCEASKKLDIADDVTYSLACFRCCLNPFLYAIIGIKFRNDLCKLFKDIGCLSQEKITEWSSAKPSRRTSFAMDTETTTTFSP.
See other products for " CCR7 "
For Research Use Only | Not For Clinical Use.
Online Inquiry