Mouse Anti-CCR7 Antibody (MO-AB-24411R)


Cat: MO-AB-24411R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24411R Monoclonal Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO24411R 100 µg
CBMOAB-69622FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69622FYA 100 µg
MO-AB-09740R Monoclonal Cattle (Bos taurus) WB, ELISA MO09740R 100 µg
MO-AB-01031Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01031Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO24411R
SpecificityThis antibody binds to Pig CCR7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR7 (C-C Motif Chemokine Receptor 7) is a Protein Coding gene. Diseases associated with CCR7 include Chronic Actinic Dermatitis and Pars Planitis. Among its related pathways are Akt Signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine (C-C motif) ligand 19 binding. An important paralog of this gene is CCR9.
Product OverviewThis product is a mouse antibody against CCR7. It can be used for CCR7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine (C-C motif) receptor 7; Chemokine receptor 7; CCR7
UniProt IDQ861S1
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MDLGKPMKKSLLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLYESVCFKKDVRTFKAWFLPVMYSIICFVGLLGNGLVMLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHVCKLIFGIYKISFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLAMVLSTPELLYSGTQKSSSEQALRCSLITEHVEALITIQVAQMVVGFLIPLVAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVAFQLPYNGVVLAQTVANFNITSGTSCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRQWSSCRHTRRSSMSAEAETTTTFSP.
See other products for " CCR7 "
For Research Use Only | Not For Clinical Use.
Online Inquiry