Mouse Anti-CD14 Antibody (MO-AB-09769R)
Cat: MO-AB-09769R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09769R | Monoclonal | Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Horse (Equus caballus), Human, Cynomolgus, Canine, Hooded, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO09769R | 100 µg | ||
| CBMOAB-00020FYA | Monoclonal | Cattle (Bos taurus) | FC | F00020FYA | 100 µg | ||
| CBMOAB-00021FYA | Monoclonal | Cattle (Bos taurus) | FC | F00021FYA | 100 µg | ||
| CBMOAB-00023FYA | Monoclonal | Cattle (Bos taurus) | FC | F00023FYA | 100 µg | ||
| CBMOAB-38622FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38622FYA | 100 µg | ||
| MO-AB-16680W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16680W | 100 µg | ||
| MO-AB-29439W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29439W | 100 µg | ||
| MO-AB-38463W | Monoclonal | Gorilla | WB, ELISA | MO38463W | 100 µg | ||
| MO-AB-43979W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43979W | 100 µg | ||
| MO-AB-52526W | Monoclonal | Marmoset | WB, ELISA | MO52526W | 100 µg | ||
| MO-AB-24426R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24426R | 100 µg | ||
| MO-AB-01043Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01043Y | 100 µg | ||
| MO-AB-07515Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07515Y | 100 µg | ||
| MO-AB-14487Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14487Y | 100 µg | ||
| MOFY-0522-FY63 | Monoclonal | Human, Cynomolgus | FC | 100 µg | |||
| MOFY-0522-FY64 | Monoclonal | Human, Cynomolgus, Canine, Hooded | FC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Horse (Equus caballus), Human, Cynomolgus, Canine, Hooded, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
| Clone | MO09769R |
| Specificity | This antibody binds to Cattle CD14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Golgi apparatus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CD14 (CD14 Molecule) is a Protein Coding gene. Diseases associated with CD14 include Mycobacterium Chelonae and Croup. Among its related pathways are Bacterial infections in CF airways and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include lipopolysaccharide binding and lipoteichoic acid binding. Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL) and mediates the cytokine release induced by LDL. |
| Product Overview | Mouse Anti-Cattle CD14 Antibody is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Monocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14 |
| UniProt ID | A6QNL0 |
| Protein Refseq | The length of the protein is 375 amino acids long. The sequence is show below: MVRVCVPYLLLLLLPSLLRVSADTTEPCELDDDDFRCVCNFTDPKPDWSSAVQCMVAVEVEISAGGRSLEQFLKGADTNPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLKELTLEDLEVTGPTPPTPLEAAGPALTTLSLRNVSWTTGGAWLGELQQWLKPGLRVLNIAQAHSLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFPALQYLALRNAGMETPSGVCAALAAARVQPQSL. |
See other products for " CD14 "
| MO-AB-34512W | Mouse Anti-CD14 Antibody (MO-AB-34512W) |
| CBMOAB-00022FYA | Mouse Anti-CD14 Antibody (CBMOAB-00022FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry