AibGenesis™ Mouse Anti-CD14 Antibody (MO-AB-09769R)


Cat: MO-AB-09769R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09769R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Horse (Equus caballus), Human, Cynomolgus, Canine, Hooded, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO09769R 100 µg
CBMOAB-00020FYA Monoclonal Cattle (Bos taurus) FC F00020FYA 100 µg
CBMOAB-00021FYA Monoclonal Cattle (Bos taurus) FC F00021FYA 100 µg
CBMOAB-00023FYA Monoclonal Cattle (Bos taurus) FC F00023FYA 100 µg
CBMOAB-38622FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38622FYA 100 µg
MO-AB-16680W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16680W 100 µg
MO-AB-29439W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29439W 100 µg
MO-AB-38463W Monoclonal Gorilla WB, ELISA MO38463W 100 µg
MO-AB-43979W Monoclonal Horse (Equus caballus) WB, ELISA MO43979W 100 µg
MO-AB-52526W Monoclonal Marmoset WB, ELISA MO52526W 100 µg
MO-AB-24426R Monoclonal Pig (Sus scrofa) WB, ELISA MO24426R 100 µg
MO-AB-01043Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01043Y 100 µg
MO-AB-07515Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07515Y 100 µg
MO-AB-14487Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14487Y 100 µg
MOFY-0522-FY63 Monoclonal Human, Cynomolgus FC 100 µg
MOFY-0522-FY64 Monoclonal Human, Cynomolgus, Canine, Hooded FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Gorilla, Horse (Equus caballus), Human, Cynomolgus, Canine, Hooded, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO09769R
SpecificityThis antibody binds to Cattle CD14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Golgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD14 Antibody is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMonocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14
UniProt IDA6QNL0
Protein RefseqThe length of the protein is 375 amino acids long.
The sequence is show below: MVRVCVPYLLLLLLPSLLRVSADTTEPCELDDDDFRCVCNFTDPKPDWSSAVQCMVAVEVEISAGGRSLEQFLKGADTNPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLKELTLEDLEVTGPTPPTPLEAAGPALTTLSLRNVSWTTGGAWLGELQQWLKPGLRVLNIAQAHSLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFPALQYLALRNAGMETPSGVCAALAAARVQPQSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry