Mouse Anti-CD28 Antibody (CBMOAB-60868FYC)


Cat: CBMOAB-60868FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60868FYC Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken, Turkey, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO60868FYC 100 µg
CBMOAB-00069FYA Monoclonal Cattle (Bos taurus) FC F00069FYA 100 µg
CBMOAB-38682FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38682FYA 100 µg
CBMOAB-63883FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO63883FYA 100 µg
MO-AB-08577W Monoclonal Cat (Felis catus) WB, ELISA MO08577W 100 µg
MO-AB-52552W Monoclonal Marmoset WB, ELISA MO52552W 100 µg
MO-AB-09807R Monoclonal Cattle (Bos taurus) WB, ELISA MO09807R 100 µg
MO-AB-24444R Monoclonal Pig (Sus scrofa) WB, ELISA MO24444R 100 µg
MO-AB-02200H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02200C 100 µg
MO-AB-24624H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24624C 100 µg
MO-AB-07523Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07523Y 100 µg
MO-AB-10834Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10834Y 100 µg
MO-AB-14494Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14494Y 100 µg
MOFY-0522-FY15 Monoclonal Chicken, Turkey FC, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken, Turkey, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO60868FYC
SpecificityThis antibody binds to Rhesus CD28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD28 (CD28 Molecule) is a Protein Coding gene. Diseases associated with CD28 include Mycosis Fungoides and Sezary''s Disease. Among its related pathways are Th2 Differentiation Pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and SH3/SH2 adaptor activity. An important paralog of this gene is CTLA4.
Product OverviewMouse Anti-Rhesus CD28 Antibody is a mouse antibody against CD28. It can be used for CD28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD28 protein; CD28
UniProt IDQ9BDM6
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MLRLLLALNLLPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYEDYSQQLQVYSKTEFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHEKGKHLCPSPLFPGPSKPFWALVVVGGVLACYSLLVTVAFSIFWMRSKRSRLLHSDYMNMTPRRPGPTRKHYQPCAPPRDFAAYRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry