AibGenesis™ Mouse Anti-CD28 Antibody (MO-AB-34516W)
Cat: MO-AB-34516W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-34516W | Monoclonal | Ferret (Mustela Putorius Furo), Cat (Felis catus), Cattle (Bos taurus), Chicken, Turkey, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO34516W | 100 µg | ||
| CBMOAB-00069FYA | Monoclonal | Cattle (Bos taurus) | FC | F00069FYA | 100 µg | ||
| CBMOAB-38682FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38682FYA | 100 µg | ||
| CBMOAB-63883FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO63883FYA | 100 µg | ||
| MO-AB-08577W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08577W | 100 µg | ||
| MO-AB-52552W | Monoclonal | Marmoset | WB, ELISA | MO52552W | 100 µg | ||
| MO-AB-09807R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09807R | 100 µg | ||
| MO-AB-24444R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24444R | 100 µg | ||
| MO-AB-02200H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02200C | 100 µg | ||
| MO-AB-24624H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24624C | 100 µg | ||
| MO-AB-07523Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07523Y | 100 µg | ||
| MO-AB-10834Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10834Y | 100 µg | ||
| MO-AB-14494Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14494Y | 100 µg | ||
| MOFY-0522-FY15 | Monoclonal | Chicken, Turkey | FC, IHC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Ferret (Mustela Putorius Furo), Cat (Felis catus), Cattle (Bos taurus), Chicken, Turkey, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO34516W |
| Specificity | This antibody binds to Ferret CD28. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Ferret CD28 Antibody is a mouse antibody against CD28. It can be used for CD28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD28; CD28 |
| UniProt ID | R4PK86 |
| Protein Refseq | The length of the protein is 221 amino acids long. The sequence is show below: MILRLLLALNFFPSIQVAENKILVKQLPMLVVYNNEVNLSCKYTHNLFSKEFRASLYKGVDSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRKLFVNQTDIYFCKIEVMYPPPYIDNEKSNGTIIHVKERHLCPVQLSPQSSKPFWALVVVCGVLVFYSFLVTVALCACWMKSRRSRILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS. |
See other products for " CD28 "
| CBMOAB-60868FYC | AibGenesis™ Mouse Anti-CD28 Antibody (CBMOAB-60868FYC) |
| CBMOAB-00068FYA | AibGenesis™ Mouse Anti-CD28 Antibody (CBMOAB-00068FYA) |
| MO-AB-29459W | AibGenesis™ Mouse Anti-CD28 Antibody (MO-AB-29459W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry