AibGenesis™ Mouse Anti-CD81 Antibody (MO-AB-09883R)


Cat: MO-AB-09883R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09883R Monoclonal Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO09883R 100 µg
CBMOAB-69718FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69718FYA 100 µg
MO-AB-09700W Monoclonal Cat (Felis catus) WB, ELISA MO09700W 100 µg
MO-AB-18509W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18509W 100 µg
MO-AB-29486W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29486W 100 µg
MO-AB-41377W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41377W 100 µg
MO-AB-44006W Monoclonal Horse (Equus caballus) WB, ELISA MO44006W 100 µg
MO-AB-52584W Monoclonal Marmoset WB, ELISA MO52584W 100 µg
MO-AB-24490R Monoclonal Pig (Sus scrofa) WB, ELISA MO24490R 100 µg
MO-AB-02214H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02214C 100 µg
MO-AB-24655H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24655C 100 µg
MO-AB-00196L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00196L 100 µg
MO-AB-01073Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01073Y 100 µg
MO-AB-14511Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14511Y 100 µg
MO-DKB-00837W Polyclonal Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, FC, IHC, IHC-P, Block 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO09883R
SpecificityThis antibody binds to Cattle CD81.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD81 Antibody is a mouse antibody against CD81. It can be used for CD81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD81 antigen; CD antigen CD81; CD81
UniProt IDQ3ZCD0
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDRPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAIVDDDANNAKAVVKTFHETLNCCGSNTLMTLTTSVLKNSLCPSSGNVITNLFKEDCHGKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY.
See other products for " CD81 "
For Research Use Only | Not For Clinical Use.
Online Inquiry