AibGenesis™ Mouse Anti-CD81 Antibody (MO-AB-09883R)
Cat: MO-AB-09883R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09883R | Monoclonal | Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO09883R | 100 µg | ||
| CBMOAB-69718FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69718FYA | 100 µg | ||
| MO-AB-09700W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09700W | 100 µg | ||
| MO-AB-18509W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18509W | 100 µg | ||
| MO-AB-29486W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29486W | 100 µg | ||
| MO-AB-41377W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41377W | 100 µg | ||
| MO-AB-44006W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44006W | 100 µg | ||
| MO-AB-52584W | Monoclonal | Marmoset | WB, ELISA | MO52584W | 100 µg | ||
| MO-AB-24490R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24490R | 100 µg | ||
| MO-AB-02214H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02214C | 100 µg | ||
| MO-AB-24655H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24655C | 100 µg | ||
| MO-AB-00196L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00196L | 100 µg | ||
| MO-AB-01073Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01073Y | 100 µg | ||
| MO-AB-14511Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14511Y | 100 µg | ||
| MO-DKB-00837W | Polyclonal | Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, FC, IHC, IHC-P, Block | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO09883R |
| Specificity | This antibody binds to Cattle CD81. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Extracellular region or secreted; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Cattle CD81 Antibody is a mouse antibody against CD81. It can be used for CD81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD81 antigen; CD antigen CD81; CD81 |
| UniProt ID | Q3ZCD0 |
| Protein Refseq | The length of the protein is 236 amino acids long. The sequence is show below: MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDRPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAIVDDDANNAKAVVKTFHETLNCCGSNTLMTLTTSVLKNSLCPSSGNVITNLFKEDCHGKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY. |
See other products for " CD81 "
For Research Use Only | Not For Clinical Use.
Online Inquiry