AibGenesis™ Mouse Anti-Cd9 Antibody (MO-AB-24662H)


Cat: MO-AB-24662H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24662H Monoclonal Rat (Rattus norvegicus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon, Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO24662C 100 µg
MO-AB-08908W Monoclonal Cat (Felis catus) WB, ELISA MO08908W 100 µg
MO-AB-21982W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21982W 100 µg
MO-AB-29493W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29493W 100 µg
MO-AB-34527W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34527W 100 µg
MO-AB-36876W Monoclonal Goat (Capra hircus) WB, ELISA MO36876W 100 µg
MO-AB-52595W Monoclonal Marmoset WB, ELISA MO52595W 100 µg
MO-AB-09891R Monoclonal Cattle (Bos taurus) WB, ELISA MO09891R 100 µg
MO-AB-24509R Monoclonal Pig (Sus scrofa) WB, ELISA MO24509R 100 µg
MO-AB-02217H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02217C 100 µg
MO-AB-23030H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23030C 100 µg
MO-AB-00199L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00199L 100 µg
MO-AB-01080Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01080Y 100 µg
MO-AB-06354Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06354Y 100 µg
MO-AB-14516Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14516Y 100 µg
MOFY-0522-FY72 Monoclonal Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon FC, IHC, IP, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon, Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO24662C
SpecificityThis antibody binds to Rat Cd9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Cd9. It can be used for Cd9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD9 antigen; CD antigen CD9; Cd9
UniProt IDP40241
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV.
For Research Use Only | Not For Clinical Use.
Online Inquiry