AibGenesis™ Mouse Anti-CD9 Antibody (MO-AB-44009W)
Cat: MO-AB-44009W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-44009W | Monoclonal | Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon, Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO44009W | 100 µg | ||
| MO-AB-08908W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08908W | 100 µg | ||
| MO-AB-21982W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21982W | 100 µg | ||
| MO-AB-29493W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29493W | 100 µg | ||
| MO-AB-34527W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34527W | 100 µg | ||
| MO-AB-36876W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36876W | 100 µg | ||
| MO-AB-52595W | Monoclonal | Marmoset | WB, ELISA | MO52595W | 100 µg | ||
| MO-AB-09891R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09891R | 100 µg | ||
| MO-AB-24509R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24509R | 100 µg | ||
| MO-AB-02217H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02217C | 100 µg | ||
| MO-AB-23030H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23030C | 100 µg | ||
| MO-AB-00199L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00199L | 100 µg | ||
| MO-AB-01080Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01080Y | 100 µg | ||
| MO-AB-06354Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06354Y | 100 µg | ||
| MO-AB-14516Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14516Y | 100 µg | ||
| MOFY-0522-FY72 | Monoclonal | Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon | FC, IHC, IP, WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human, Hamster, Canine, Feline, Monkey, Rabbit, Raccoon, Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Sheep (Ovis aries) |
| Clone | MO44009W |
| Specificity | This antibody binds to Horse CD9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Horse CD9 Antibody is a mouse antibody against CD9. It can be used for CD9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tetraspanin; CD9 |
| UniProt ID | F6WQJ4 |
| Protein Refseq | The length of the protein is204 amino acids long. The sequence is show below: LAGIAVLAIGLWLRFDSQTKSIFEQENNNSSFYTGVYILIGAGALIMVVGFLGCCGAVQESQCMLGLFFCFLLVIFAIEIAAAIWGYSHKDEVIKDIQEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGIVGGVEQFISDICPQKDVLSSFTTKPCPEAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV. |
See other products for " CD9 "
| CBMOAB-00087FYA | AibGenesis™ Mouse Anti-Bison CD9 Antibody (CBMOAB-00087FYA) |
| MO-AB-24662H | AibGenesis™ Mouse Anti-Cd9 Antibody (MO-AB-24662H) |
| CBMOAB-38748FYA | AibGenesis™ Mouse Anti-CD9 Antibody (CBMOAB-38748FYA) |
| CBMOAB-00086FYA | AibGenesis™ Mouse Anti-CD9 Antibody (CBMOAB-00086FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry