AibGenesis™ Mouse Anti-CDIP1 Antibody (MO-AB-24251W)


Cat: MO-AB-24251W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24251W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO24251W 100 µg
MO-AB-24681H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24681C 100 µg
MO-AB-52682W Monoclonal Marmoset WB, ELISA MO52682W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO24251W
SpecificityThis antibody binds to Chimpanzee CDIP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationLysosome; Endosome; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee CDIP1 Antibody is a mouse antibody against CDIP1. It can be used for CDIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 16 open reading frame 5; C16H16orf5; C16orf5
UniProt IDH2R0T9
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MSNEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry