AibGenesis™ Mouse Anti-CDRT4 Antibody (MO-AB-10005R)


Cat: MO-AB-10005R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10005R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO10005R 100 µg
MO-AB-23335W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23335W 100 µg
MO-AB-24708H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24708C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO10005R
SpecificityThis antibody binds to Cattle CDRT4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CDRT4 Antibody is a mouse antibody against CDRT4. It can be used for CDRT4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMT1A duplicated region transcript 4 protein homolog; CDRT4
UniProt IDQ2YDL7
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MERLDARKMKMEEVELTENIGLPVNLLEKHDPWPAYVTYTSPMVKRLIEKSKARELECLQTVEESRRVGKQSKPASLIQLKRRKSSKSSGTTTFKDLRSETMLSVWGPLTMSAMGPSGVPEPLHLHSDSRASPTASYNKIIFARAPTMRTLPYTAGRPSEMFCI.
For Research Use Only | Not For Clinical Use.
Online Inquiry