AibGenesis™ Mouse Anti-Cdsa Antibody (CBMOAB-03293FYA)


Cat: CBMOAB-03293FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03293FYA Monoclonal Fruit fly (Drosophila melanogaster), E. coli (Escherichia coli ) WB, ELISA MO03293FYA 100 µg
CBMOAB-0335YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0335YC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), E. coli (Escherichia coli )
CloneMO03293FYA
SpecificityThis antibody binds to fruit fly Cdsa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), an important precursor for the synthesis of phosphatidylinositol (PtdIns) and phosphatidylglycerol (PG) (PubMed:7816135, PubMed:24603715). Required for the regeneration of the signaling molecule phosphatidylinositol 4,5-bisphosphate (PtdInsP2) from PA and maintenance of its steady supply during signaling thus playing an essential role during phospholipase C-mediated transduction (PubMed:7816135). In the salivary glands and possibly other adipose tissues, function is essential for regulating cell growth and neutral lipid storage by coordinating PtdIns metabolism and insulin pathway activity (PubMed:24603715). Acts by positively regulating activity of the insulin pathway through synthesis of PtdIns, and in turn the insulin pathway up-regulates the synthesis of CdsA (PubMed:24603715). This CdsA-insulin positive feedback loop may be one of the mechanisms for coordinating cell growth and fat storage; switching to fat storage when cells reach homeostasis or converting from growth to fat storage under nutrient-poor conditions (PubMed:24603715). Required for spermatid individualization by regulating lipid compositions and lipid-mediated signaling during spermatogenesis (PubMed:26791243). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cdsa Antibody is a mouse antibody against Cdsa. It can be used for Cdsa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidate cytidylyltransferase, photoreceptor-specific; EC 2.7.7.41; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase; CdsA
UniProt IDP56079
Protein RefseqThe length of the protein is 447 amino acids long.
The sequence is show below: MAEVRRRKGEDEPLEDTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELAKNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNLGDMLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry