AibGenesis™ Mouse Anti-Ced-6 Antibody (CBMOAB-03306FYA)


Cat: CBMOAB-03306FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03306FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO03306FYA 100 µg
Inquiry
MO-AB-69464W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69464W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO03306FYA
SpecificityThis antibody binds to fruit fly Ced-6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a role in axon pruning in larval mushroom body neurons during metamorphosis (PubMed:16772168). Plays a role in the infiltration of glial cell processes into mushroom body lobes and the subsequent engulfment of degenerating axon branches (PubMed:16772168). Involved in Drpr-mediated phagocytosis of apoptotic cells (PubMed:19927123). Required for bacterial phagocytosis (PubMed:19890048). During neuromuscular junction development, required for the clearance of pruned ghost boutons and presynaptic debris and for normal synaptic growth (PubMed:19707574). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Ced-6 Antibody is a mouse antibody against Ced-6. It can be used for Ced-6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCed-6, isoform B; ced-6
UniProt IDE2QC90
Protein RefseqThe length of the protein is 517 amino acids long.
The sequence is show below: MPYQPANSGGTSGGSKAAAKMAQLKFWNKQNSSKQQQQDKDKDAADGGNNTSGGGTGSNSNGDAKSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASDITLTIGQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALLFNLGIKDILEAPTTEPQNGIEVASEALSNGKLDDDKLLIDTNSTTASTHSASPSSFLPIVPPRNNLSSQISIGGKSNSQKMDELLLNSDSDSDFDPRADETQEIGGTGRSAISNMFGFEPANSFGQHLFSNNNDHKLQNNNSSLLITSNNNSINSSGFSSELNITPPLLAPPPKIAAPRRLNSVTTGNGLNGNTDLFGSDPFELNNGPNIFKQNQLNLDDFSLESLDPLRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry