AibGenesis™ Mouse Anti-CERS5 Antibody (CBMOAB-39078FYA)


Cat: CBMOAB-39078FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39078FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO39078FYA 100 µg
CBMOAB-70149FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70149FYA 100 µg
MO-AB-02343H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02343C 100 µg
MO-AB-10089R Monoclonal Cattle (Bos taurus) WB, ELISA MO10089R 100 µg
MO-AB-13956W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13956W 100 µg
MO-AB-52860W Monoclonal Marmoset WB, ELISA MO52860W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO39078FYA
SpecificityThis antibody binds to Rhesus CERS5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins. The encoded protein functions in the synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus CERS5 Antibody is a mouse antibody against CERS5. It can be used for CERS5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCERS5
UniProt IDF7G8B2
Protein RefseqThe length of the protein is 392 amino acids long.
The sequence is show below: MATAAQGPLSLLWGWLWSERFWLPQNVTWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAKPCALHIGIEDSGPYQAQPNAILEKVFVSITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTRFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYYYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRAGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQVLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry