AibGenesis™ Mouse Anti-CGT Antibody (CBMOAB-22129FYB)


Cat: CBMOAB-22129FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22129FYB Monoclonal Rice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Tomato (Lycopersicon esculentum) WB, ELISA MO22129FYB 100 µg
MO-AB-01143Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01143Y 100 µg
MO-AB-10129R Monoclonal Cattle (Bos taurus) WB, ELISA MO10129R 100 µg
MO-AB-34282H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34282C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Cattle (Bos taurus), Chicken (Gallus gallus), Tomato (Lycopersicon esculentum)
CloneMO22129FYB
SpecificityThis antibody binds to Rice CGT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUDP-glucose-dependent glucosyltransferase catalyzing the c-glucosylation of 2-hydroxyflavanones. Acts preferentially on the dibenzoylmethane tautomers formed in equilibrium with 2-hydroxyflavanones. No activity with naringenin or naringenin chalcone. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice CGT Antibody is a mouse antibody against CGT. It can be used for CGT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-glucosyltransferase; CGT
UniProt IDC3W7B0
Protein RefseqThe length of the protein is 471 amino acids long.
The sequence is show below: MPSSGDAAGRRPHVVLIPSAGMGHLVPFGRLAVALSSGHGCDVSLVTVLPTVSTAESKHLDALFDAFPAVRRLDFELAPFDASEFPGADPFFLRFEAMRRSAPLLGPLLTGAGASALATDIALTSVVIPVAKEQGLPCHILFTASAAMLSLCAYFPTYLDANAGGGGGVGDVDIPGVYRIPKASIPQALHDPNHLFTRQFVANGRSLTSAAGILVNTFDALEPEAVAALQQGKVASGFPPVFAVGPLLPASNQAKDPQANYMEWLDAQPARSVVYVSFGSRKAISREQLRELAAGLEGSGHRFLWVVKSTVVDRDDAAELGELLDEGFLERVEKRGLVTKAWVDQEEVLKHESVALFVSHCGWNSVTEAAASGVPVLALPRFGDQRVNSGVVARAGLGVWADTWSWEGEAGVIGAEEISEKVKAAMADEALRMKAASLAEAAAKAVAGGGSSHRCLAEFARLCQGGTCRTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry