AibGenesis™ Mouse Anti-ch25h Antibody (CBMOAB-70268FYA)


Cat: CBMOAB-70268FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70268FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO70268FYA 100 µg
MO-AB-10130R Monoclonal Cattle (Bos taurus) WB, ELISA MO10130R 100 µg
MO-AB-23307W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23307W 100 µg
MO-AB-24577R Monoclonal Pig (Sus scrofa) WB, ELISA MO24577R 100 µg
MO-AB-52890W Monoclonal Marmoset WB, ELISA MO52890W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO70268FYA
SpecificityThis antibody binds to Zebrafish ch25h.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ch25h Antibody is a mouse antibody against ch25h. It can be used for ch25h detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCholesterol 25-hydroxylase-like protein; EC 1.14.99.-; ch25
UniProt IDQ5PRC0
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MFGLQHIWDCILQYEAQLRSPFFPVLFSITVYLSFCLPFVLLDALSPKVELIRRYKIQQKASVSWTMMWSCLALSLYNHVVYIFPLSVLHWYWRPVSYLAEAPGVLRVVWDLAACLLLFDFQYFVWHLLHHKVPWLYRTFHKVHHKYTSTFALATEYSGAWETLSLGFFAAVNPMLLGVHPMTEMLFHMLNMWLSVEDHCGYDLPWATHRLMPFGLYGGAPHHDVHHQKFKSNYAPYFTHWDKLFGTLHFE.
For Research Use Only | Not For Clinical Use.
Online Inquiry