AibGenesis™ Mouse Anti-chic2 Antibody (CBMOAB-70379FYA)


Cat: CBMOAB-70379FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70379FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO70379FYA 100 µg
MO-AB-02382H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02382C 100 µg
MO-AB-10166R Monoclonal Cattle (Bos taurus) WB, ELISA MO10166R 100 µg
MO-AB-11374W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11374W 100 µg
MO-AB-24770H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24770C 100 µg
MO-AB-52941W Monoclonal Marmoset WB, ELISA MO52941W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO70379FYA
SpecificityThis antibody binds to Zebrafish chic2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. (From NCBI)
Product OverviewMouse Anti-Zebrafish chic2 Antibody is a mouse antibody against chic2. It can be used for chic2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChic2 protein; Cysteine-rich hydrophobic domain 2; chic
UniProt IDQ802W1
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MEDFDEIYEEEEEEEEDEDRAAEEQLLKYAPDPVVVRGSGHVTVFGLSNKFESEFPSALTGKVAPEEFKSSINRVNSCLRKALPVNVRWLLCGCLCCCCTLGFSLWPVICLSKRTRRSIEKLLEWENSRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKIPIFRPD.
For Research Use Only | Not For Clinical Use.
Online Inquiry