Mouse Anti-Chicken FAS Antibody (MO-AB-01855Y)
Cat: MO-AB-01855Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO01855Y |
Specificity | This antibody binds to Chicken FAS. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Plasma membrane; Cytosol; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq, Mar 2011] |
Product Overview | This product is a mouse antibody against FAS. It can be used for FAS detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fatty acid synthase; FAS |
UniProt ID | F1P2Q5 |
Protein Refseq | The length of the protein is 339 amino acids long. The sequence is show below: MARGLFHLLLVIVLVMETHCINDTEVPTHTAHNKSITRKRNIAKREITCGEGNYSFSGQCCTKCKRGHVKSIDCPKTQAHCVPCKSGEEYMDHINDLDECMRCRSCDKALGLEVVKNCTSTENAECSCAKNHYCNSSRCEHCESCTVCENGQIEKECTSTSDTVCRMQVKRKVNNYTTQGNTAAADTGKVHSPETLRLIHIDVDLTHHVPDIVREMTLRQVITFVRHHRLSEPTIEETLLDNSNNTSEQKIKLFQKWYQKHGMGGAYETLICSLRDLKMCTAADKIERKLKAAVSSHQERRESYNDKTEQSNTCSQEGEKCYDDNAEISKTYPESLEET. |
See other products for " FAS "
MO-AB-25767R | Mouse Anti-Pig FAS Antibody (MO-AB-25767R) |
MO-AB-12374R | Mouse Anti-Cattle FAS Antibody (MO-AB-12374R) |
MOFY-0722-FY129 | Rabbit Anti-FAS Antibody (MOFY-0722-FY129) |
MO-AB-05025Y | Mouse Anti-A. aegpti fas Antibody (MO-AB-05025Y) |
MO-AB-44719W | Mouse Anti-Horse fas Antibody (MO-AB-44719W) |
CBMOAB-76114FYA | Mouse Anti-Zebrafish fas Antibody (CBMOAB-76114FYA) |
CBMOAB-42588FYA | Mouse Anti-Rhesus FAS Antibody (CBMOAB-42588FYA) |
MO-AB-08050Y | Mouse Anti-Rabbit FAS Antibody (MO-AB-08050Y) |
MO-AB-19797W | Mouse Anti-Chimpanzee FAS Antibody (MO-AB-19797W) |
MO-AB-23203H | Mouse Anti-Mallard FAS Antibody (MO-AB-23203H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry