Mouse Anti-Horse fas Antibody (MO-AB-44719W)


Cat: MO-AB-44719W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44719W
SpecificityThis antibody binds to Horse fas.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Product OverviewMouse Anti-Horse fas Antibody is a mouse antibody against fas. It can be used for fas detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFas; fas
UniProt IDC9DTZ5
Protein RefseqThe length of the protein is137 amino acids long.
The sequence is show below: CSSCEHCDPCITCKHGIIENCTPTNDAKCREGSGSNLYWLFCLLFLLLIAVFLLKRYGLKRRCRNEEDDYRVCGDSNTEMEQRNLPDIDLSKYISSIAEQMELNQVKEFARKNGIEEAKIDEIENDNPNETAEQKSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry