Mouse Anti-Chicken RYK Antibody (MO-AB-03884Y)
Cat: MO-AB-03884Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO03884Y |
Specificity | This antibody binds to Chicken RYK. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Product Overview | This product is a mouse antibody against RYK. It can be used for RYK detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tyrosine kinase RYK; RYK |
UniProt ID | Q9YI44 |
Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: VHRDLAARNCVIDDALQVKITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWSFG. |
See other products for " ryk "
MO-AB-07385H | Mouse Anti-Frog ryk Antibody (MO-AB-07385H) |
MO-AB-09799Y | Mouse Anti-Rabbit Ryk Antibody (MO-AB-09799Y) |
MO-AB-28923R | Mouse Anti-Pig RYK Antibody (MO-AB-28923R) |
CBMOAB-96945FYA | Mouse Anti-Zebrafish ryk Antibody (CBMOAB-96945FYA) |
MO-AB-28775H | Mouse Anti-Rat ryk Antibody (MO-AB-28775H) |
MO-AB-05761W | Mouse Anti-Rhesus RYK Antibody (MO-AB-05761W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry