Mouse Anti-Pig RYK Antibody (MO-AB-28923R)


Cat: MO-AB-28923R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO28923R
SpecificityThis antibody binds to Pig RYK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewThis product is a mouse antibody against RYK. It can be used for RYK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRYK receptor-like tyrosine kinase, Fragment; RYK
UniProt IDQ6WKZ9
Protein RefseqThe length of the protein is 33 amino acids long.
The sequence is show below: TDNALSRDLFPMDYHCLGDNENRPVRWMALESL.
For Research Use Only | Not For Clinical Use.
Online Inquiry