Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Chimpanzee ABCC6 Antibody (MO-AB-10828W)


Cat: MO-AB-10828W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO10828W
SpecificityThis antibody binds to Chimpanzee ABCC6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.
Product OverviewMouse Anti-Chimpanzee ABCC6 (clone MO10828W) Antibody (MO-AB-10828W) is a mouse antibody against ABCC6. It can be used for ABCC6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family C (CFTR / MRP), member 6; ABCC6
UniProt IDK7C3L9
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNGGGRQGTGWNLVKS.

See other products for " ABCC6 "

For Research Use Only | Not For Clinical Use.

Online Inquiry