Mouse Anti-Chimpanzee ABCC6 Antibody (MO-AB-10828W)


Cat: MO-AB-10828W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO10828W
SpecificityThis antibody binds to Chimpanzee ABCC6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.
Product OverviewMouse Anti-Chimpanzee ABCC6 Antibody is a mouse antibody against ABCC6. It can be used for ABCC6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family C (CFTR / MRP), member 6; ABCC6
UniProt IDK7C3L9
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNGGGRQGTGWNLVKS.
See other products for " ABCC6 "
For Research Use Only | Not For Clinical Use.
Online Inquiry