Mouse Anti-Chimpanzee AOC1 Antibody (MO-AB-18368W)


Cat: MO-AB-18368W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO18368W
SpecificityThis antibody binds to Chimpanzee AOC1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Chimpanzee AOC1 (clone MO18368W) Antibody (MO-AB-18368W) is a mouse antibody against AOC1. It can be used for AOC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat and SAM domain-containing protein 6
UniProt IDH2R2M5
Protein RefseqThe length of the protein is 751 amino acids long.
The sequence is show below: MGSMRNEDSPFGLWRTRLRNGAPLTRLPSDKLKAVIPPFLPPSSFELWSSDRSRTRHNGKADPMKTALPQRASRGHPVGGGGTDTTPVRPVKFPSLPRSPASSANSGNFNHSPHSSGGSSGVGVSRHGGELLNRSGGSIDNVLSQIAAQRKKAAGLSEQKPSHRSSPVGPAPGSSPSELPASPAGGSAPVGKQKLETSKRPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGTLKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSFESSASNTRAPGNSPSMVGWVRPEETASGKR.
For Research Use Only | Not For Clinical Use.

Online Inquiry