Mouse Anti-Chimpanzee COX11 Antibody (MO-AB-17711W)


Cat: MO-AB-17711W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO17711W
SpecificityThis antibody binds to Chimpanzee COX11.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX11 (COX11, Cytochrome C Oxidase Copper Chaperone) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity.
Product OverviewMouse Anti-Chimpanzee COX11 (clone MO17711W) Antibody (MO-AB-17711W) is a mouse antibody against COX11. It can be used for COX11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOX11 cytochrome c oxidase assembly homolog; COX11
UniProt IDK7A1T8
Protein RefseqThe length of the protein is 276 amino acids long.
The sequence is show below: MGGLWRPAWRGVAFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRVRHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN.
For Research Use Only | Not For Clinical Use.

Online Inquiry