Mouse Anti-Chimpanzee GATA4 Antibody (MO-AB-26861W)
Cat: MO-AB-26861W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO26861W |
Specificity | This antibody binds to Chimpanzee GATA4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Chimpanzee GATA4 Antibody is a mouse antibody against GATA4. It can be used for GATA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GATA4; GATA4 |
UniProt ID | A2T789 |
Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: PVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA. |
See other products for " GATA4 "
MO-AB-30907W | Mouse Anti-Dog GATA4 Antibody (MO-AB-30907W) |
CBMOAB-33749FYC | Mouse Anti-Arabidopsis GATA4 Antibody (CBMOAB-33749FYC) |
MO-AB-48171W | Mouse Anti-Maize GATA4 Antibody (MO-AB-48171W) |
MO-AB-08177Y | Mouse Anti-Rabbit GATA4 Antibody (MO-AB-08177Y) |
MO-AB-03822H | Mouse Anti-Frog gata4 Antibody (MO-AB-03822H) |
CBMOAB-77585FYA | Mouse Anti-Zebrafish gata4 Antibody (CBMOAB-77585FYA) |
MO-AB-02033Y | Mouse Anti-Chicken GATA4 Antibody (MO-AB-02033Y) |
MO-AB-25954H | Mouse Anti-Rat gata4 Antibody (MO-AB-25954H) |
CBMOAB-43398FYA | Mouse Anti-Rhesus GATA4 Antibody (CBMOAB-43398FYA) |
MO-AB-15381Y | Mouse Anti-Sheep GATA4 Antibody (MO-AB-15381Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry