Mouse Anti-Zebrafish gata4 Antibody (CBMOAB-77585FYA)


Cat: CBMOAB-77585FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO77585FYA
SpecificityThis antibody binds to Zebrafish gata4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish gata4 Antibody is a mouse antibody against gata4. It can be used for gata4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGATA4; gata
UniProt IDQ09JY7
Protein RefseqThe length of the protein is 352 amino acids long.
The sequence is show below: MYQGVTMAANHGAASYESGFLHNSTSPVYVTPTRVTPMIQALPYLQAPQQSSPASGHSGWAQPGVETTSYNSSTGHHHSPVSRFTFSTSPPLTSGRDTATYTSREHFGSRALSGSYHSGYPAYVSPNIGASWTASHFDSSVLHSLQTGGAAAARHPNLEFFDDLGEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLVKPQRRLSASRRVGLSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKTKPGSSEGQSAISAVNSSPTEETRPIKTEPDTTPLYTHHNIHTQVSAFPAYMGSPSGSSSSKSEVWNSLILA.
For Research Use Only | Not For Clinical Use.
Online Inquiry