Mouse Anti-Chimpanzee GNMT Antibody (MO-AB-25953W)


Cat: MO-AB-25953W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO25953W
SpecificityThis antibody binds to Chimpanzee GNMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644.
Product OverviewMouse Anti-Chimpanzee GNMT Antibody is a mouse antibody against GNMT. It can be used for GNMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycine N-methyltransferase; EC 2.1.1.20; GNMT
UniProt IDH2QT12
Protein RefseqThe length of the protein is 295 amino acids long.
The sequence is show below: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD.
See other products for " gnmt "
CBMOAB-78220FYAMouse Anti-Zebrafish gnmt Antibody (CBMOAB-78220FYA)
CBMOAB-17926FYAMouse Anti-D. melanogaster Gnmt Antibody (CBMOAB-17926FYA)
MO-AB-00565LMouse Anti-Elephant GNMT Antibody (MO-AB-00565L)
MO-AB-56150WMouse Anti-Marmoset GNMT Antibody (MO-AB-56150W)
MO-AB-26161RMouse Anti-Pig GNMT Antibody (MO-AB-26161R)
MO-AB-08237YMouse Anti-Rabbit GNMT Antibody (MO-AB-08237Y)
CBMOAB-43783FYAMouse Anti-Rhesus GNMT Antibody (CBMOAB-43783FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry